PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0049700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 434aa    MW: 46919.3 Da    PI: 6.7834
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0049700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
   Spipo0G0049700 14 KGPWTPEEDQKLLAYIEEHGHGCWRSLPSKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.81.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia++++ +Rt++++k++w+++l
   Spipo0G0049700  67 RGKFSVQEEQTIIQLHALLGNR-WSAIASHLP-KRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.455961IPR017930Myb domain
SuperFamilySSF466895.5E-3011108IPR009057Homeodomain-like
SMARTSM007177.7E-151363IPR001005SANT/Myb domain
PfamPF002492.1E-161461IPR001005SANT/Myb domain
CDDcd001673.96E-121661No hitNo description
PROSITE profilePS5129425.562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-2665116IPR009057Homeodomain-like
SMARTSM007174.5E-1766114IPR001005SANT/Myb domain
PfamPF002497.0E-1667112IPR001005SANT/Myb domain
CDDcd001677.96E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MGRSPCCEKV GLKKGPWTPE EDQKLLAYIE EHGHGCWRSL PSKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SVQEEQTIIQ LHALLGNRWS AIASHLPKRT DNEIKNFWNT HLKKRLAKMG  120
IDPVTHKPRC DTLSPADSNV AKASASLSHM AQWESARLEA EARLVREAKL LCFASSSVAS  180
LGASSVSSAA ASPFQLPLLV SDSSSSHVEL HNESAASSAP APPPCFDVLR AWQGIWRRGS  240
TRGRGEAQSS RDGKIDLESP TSTLTFSEAV LPERAMGLGS QHNSSSIAHR CGGEGDMEGE  300
EEVDWKYFPK PMQLFFGSRE RTTDGFTGAT FPVDSSSLFG ADSVASWLHE SAKIGPGSTA  360
ASAIGHFGDG FTEMLLNNAD EHSSPGAADG CTHEMADAGK PNSENEENRS YWNSIFNLVT  420
SSSASNSPDC VLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258286.11e-145PREDICTED: transcription factor MYB34-like
TrEMBLC6G4161e-135C6G416_THATH; MYB transcription factor ML2
STRINGBGIOSGA026935-PA1e-125(Oryza sativa Indica Group)
STRINGLOC_Os08g33660.11e-125(Oryza sativa Japonica Group)
STRINGORGLA08G0137800.11e-125(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-103myb domain protein 16